Leiurus abdullahbayrami Güneydoğu Anadolu bölgesinde yayılış gösteren ve halk sağlığı açısından önemli bir akrep türüdür. Bu çalışma Türkiye için endemik bir değeri olan Leiurus abdullahbayrami’ nin sahip olduğu venom içeriğinin aydınlatılmasına odaklanmıştır.
Akreplerden ham venom elektostimülasyon tekniği kullanılarak elde edilmiştir. Ham venomun kromotografik olarak ayrımı Yüksek Performans Sıvı Kromatografisi’ nde (HPLC) gerçekleştirilmiş ve en az 42 farklı fraksiyon elde edilmiştir. 33, 01 alıkonma zamanına sahip letal ve majör bileşenlerden olan peptid belirlenmiş ve çalışmalara bu peptid ile devam edilmiştir. Peptidin moleküler ağırlığı kütle spektrometresi (MS) ile 6809,55 Da. olarak bulunmuştur. Protein sekanslama çalışmaları Edman degradasyonu yöntemi ile gerçekleştirilmiştir. Asp-N endopeptidaz enzimi ile yıkılarak sekanslanan saf peptidin 64 aminoasit uzunluğuna sahip, 4 disülfid bağı ile paketlenmiş olduğu belirlenmiştir. Tüm dizilim VRDGYIAKPENCVYHCIPDCDTLCKDNGGTGGH CGFKLGHGIACWCNALPDNVGIIVDGVKCHK olarak bulunmuştur. BLAST benzerlik analizi ile peptid dizilimine en yakın dizilim %98’ lik oranla Leiurus quinquestriatus habreus’ tan saflaştırılan Lqh6 peptidi olarak bulunmuştur. Yapısal özelliklerinden yola çıkılarak elektrofizyolojik çalışmalar Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.5, Nav1.6 ve Nav1.7 kanalları üzerinde gerçekleştirilmiştir. Peptidin özellikle Nav1.1 Nav1.3 ve Nav1.4 kanalları olmak üzere çalışılan tüm Na+ kanalları üzerinde etkili olduğu belirlenmiştir.
Bu tez çalışması ile Leiurus abdullahbayrami nedeni ile oluşan zehirlenmelerdeki semptomların aydınlatılması ve mekanizmasının açıklanabilmesi için 33,01 dakika alıkonma zamanına sahip toksik peptidin birincil yapısı aydınlatılmış, elektrofizyolojik teknikler ile etkin olduğu iyon kanalı belirlenmiş ve bilgilerimize göre Leiurus abdullahbayrami türünden ilk saflaştırılan peptid olması nedeni ile Lab1 olarak adlandırılmıştır.
Leiurus abdullahbayrami is a kind of scorpion spreading in the Southestarn part of Turkey and important for public health. This study focused on illuminating the venom content of Leiurus abdullahbayrami, an endemic value for Turkey.
Crude venom was obtained by electrostimulation technique from scorpions. Chromatographic separation of crude venom was performed on High Performance Liquid Chromatography (HPLC) and at least 42 different fractions were obtained. The peptide has 33,01 RT, lethal and major was determined. Studies were continued with this peptide. The molecular weight of the peptide was determined by mass spectrometry (MS) to 6809.55 Da. Protein sequencing studies were performed by Edman degradation method. It was determined that the pure peptide sequenced by digestion with Asp-N endopeptidase enzyme has a length of 64 amino acids and packaged with 4 disulfide bonds. All sequences were found as VRDGYIAKPENCVYHCIPDCDTLCKDNGGTGGHCGFKLGHGIAC WCNALPDNVGIIVDGVKCHK. By BLAST similarity analysis, the closest sequence to peptide sequence was found as 98% of Lqh6 peptide purified from Leiurus quinquestriatus habreus. From the structural characteristics, electrophysiological studies were carried out on the channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.5, Nav1.6 and Nav1.7. Peptide was found effective on all type of Na+ channel types. Particularly effective on Nav1.1 Nav1.3 and Nav1.4 channels.
In this thesis study, the primary structure of toxic peptide with a retention time of 33.01 minutes was elucidated in order to clarify the mechanism and the illumination of the symptoms,electrophysiological techniques are effective in determining ion channels of poisoning caused by Leiurus abdullahbayrami. For our information, it is called Lab1 with the reason that it is the first purified peptide from Leiurus abdullahbayrami.
